PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca3939.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TALE
Protein Properties Length: 137aa    MW: 15455.4 Da    PI: 9.6122
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca3939.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.47.8e-061061341945
                HHH..SSS--HHHHHHHHHHCTS-HHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVk 45 
                Fe   ++yps ++++ LA+k+gL+ +qV+
  Dca3939.1 106 FEHflHPYPSDTDKQMLAQKTGLSRSQVS 134
                665559*********************96 PP

2BELL316.2e-116364272
       BELL 42 glgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
               g+g+a+p++s+A +a+ rhF cLk+ai +qi
  Dca3939.1  6 GYGNAAPFISFAVRAMFRHFHCLKNAILDQI 36
               99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075266.0E-6632IPR006563POX domain
SuperFamilySSF466891.58E-975134IPR009057Homeodomain-like
CDDcd000861.21E-787133No hitNo description
Gene3DG3DSA:1.10.10.609.8E-1787134IPR009057Homeodomain-like
PfamPF059203.0E-11104135IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MQSKEGYGNA APFISFAVRA MFRHFHCLKN AILDQIRVSS KGFGSGEDSR RERDLGSCPD  60
DKSPYDPKQN MGQDHGSGAN FLQHPVWRSQ RGFPDKAVAV LRTWLFEHFL HPYPSDTDKQ  120
MLAQKTGLSR SQVSLSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687910.12e-57PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A0K9RBJ41e-58A0A0K9RBJ4_SPIOL; Uncharacterized protein
STRINGPOPTR_0008s06130.13e-39(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.19e-33TALE family protein